THE HALFAX HEIMDALL AUGUR

2026-07-10 02:04:45 UTC

← all entities

Army org

first seen 45d ago · last seen 22m ago · 204 mentions · 61 clusters · 51 corroborations

Corroborated stories featuring this entity · 50

4 corroborated · 29m ago · cluster ↗ · blueskycnn.comgdeltguardianwtae · 19 events

President Donald Trump proposes a 250-foot triumphal arch in Washington, D.C.

President Donald Trump proposes a 250-foot triumphal arch in Washington, D.C.
otherwestern
The National Capital Planning Commission gave preliminary approval to site and building plans for the arch.
otherwestern
4 corroborated · 4h ago · cluster ↗ · alarabiyablueskymiddleeasteyetasstheyeshivaworld.com · 18 events

Israel Defence Minister Israel Katz said Israel was prepared to resume military operations against Iran if needed.

Israel Defence Minister Israel Katz said Israel was prepared to resume military operations against Iran if needed.
gulfmideast_ind
Katz said the army is ready and on alert for a resumption of fighting to regain air superiority and strike Iran again.
gulfmideast_ind
1 corroborated · 8h ago · cluster ↗ · alarabiyaallafricadwfrance24gdeltnbcnews.com · 17 events

The attacks targeted the towns/cities of Anefis, Aguelhoc (or Aguelhok), Gao, Sevare, and Kenioroba/Kenieroba.

The attacks targeted the towns/cities of Anefis, Aguelhoc (or Aguelhok), Gao, Sevare, and Kenioroba/Kenieroba.
gulfother
2 corroborated · 1d ago · cluster ↗ · blueskycnn.comgdeltwtae · 19 events

President Donald Trump proposes a 250‑foot triumphal arch.

President Donald Trump proposes a 250‑foot triumphal arch.
otherwestern
The arch would be near the Lincoln Memorial.
western
6 corroborated · 2d ago · cluster ↗ · alarabiyaallafricadwfrance24gdeltnbcnews.com · 17 events

Insurgents staged coordinated attacks on army positions across Mali on Saturday.

Insurgents staged coordinated attacks on army positions across Mali on Saturday.
gulfotherwestern
The attacks targeted the towns of Anefis, Aguelhoc, Gao, Sevare and Kenioroba.
gulfother
0 corroborated · 2d ago · cluster ↗ · eurasiantimes.comscmp · 12 events

Recent PLA exercises showed that China's older aircraft carriers could operate more closely in tandem with the more advanced Fujian than previously thought.

0 corroborated · 3d ago · cluster ↗ · alarabiyaallafricadwfrance24gdeltnbcnews.com · 17 events

The attacks targeted the towns of Anefis, Aguelhoc (Aguelhok), Gao, Sevare and Kenioroba.

1 corroborated · 4d ago · cluster ↗ · allafricathenationonlineng.net · 8 events

Military personnel attached to the Army Depot in Osogbo invaded off‑campus/private hostels housing students of the University of Osun (UNIOSUN) on Monday night.

Military personnel attached to the Army Depot in Osogbo invaded off‑campus/private hostels housing students of the University of Osun (UNIOSUN) on Monday night.
africaother
4 corroborated · 4d ago · cluster ↗ · alarabiyadwfrance24gdeltnbcnews.com · 17 events

Insurgents staged coordinated attacks on army positions across Mali on Saturday.

Insurgents staged coordinated attacks on army positions across Mali on Saturday.
gulfotherwestern
The attacks targeted the towns of Anefis, Aguelhoc, Gao, Sevare and Kenioroba.
gulfother
8 corroborated · 4d ago · cluster ↗ · allafricaallafrica.comdailypost.nggmtnewsng.comguardian.ngthenationonlineng.net · 8 events

The soldiers confiscated or carted away students' belongings, including mobile phones.

The soldiers confiscated or carted away students' belongings, including mobile phones.
africaother
The university accused the operatives of assaulting students and confiscating their belongings.
africaother
3 corroborated · 4d ago · cluster ↗ · allafricaallafrica.comdailypost.nggmtnewsng.comthenationonlineng.netwithinnigeria.com · 8 events

Military personnel attached to the Army Depot in Osogbo invaded off‑campus hostels housing UNIOSUN students on Monday night.

Military personnel attached to the Army Depot in Osogbo invaded off‑campus hostels housing UNIOSUN students on Monday night.
africaother
The university accused the operatives of assaulting students.
africaother
4 corroborated · 4d ago · cluster ↗ · alarabiyadwfrance24gdeltnbcnews.com · 17 events

Insurgents staged attacks on army positions across Mali on Saturday

Insurgents staged attacks on army positions across Mali on Saturday
gulfwestern
The attacks targeted the towns of Anefis, Aguelhoc (Aguelhok), Gao, Sevare and Kenioroba (Kenieroba) across Mali
gulfother
2 corroborated 1 contested · 5d ago · cluster ↗ · theprint.intimesofindia · 11 events

Both Rayees Khan and Mohammad Sajad are being questioned by authorities.

Both Rayees Khan and Mohammad Sajad are being questioned by authorities.
indiaother
Mohammad Sajad, a Pakistani national, was apprehended near the Line of Control in Poonch on Friday.
indiaother
0 corroborated · 6d ago · cluster ↗ · allafricadailypost.ng · 9 events

The Nigerian Army has reviewed its recruit training curriculum.

0 corroborated · 6d ago · cluster ↗ · eurasiantimes.comscmp · 12 events

China’s older aircraft carriers could operate more closely in tandem with the more advanced Fujian than previously thought.

3 corroborated 3 contested · 9d ago · cluster ↗ · freepressjournal.inhindutimesofindia · 11 events

The incident occurred around 6:30 am or 7 am on Tuesday morning.

The incident occurred around 6:30 am or 7 am on Tuesday morning.
indiaother
The borewell was located in Dhanaura village (Ambala) or Dhanyoda village near Shahpur.
indiaother
7 corroborated · 9d ago · cluster ↗ · freepressjournal.inhinduhindustantimes.comindiatoday.inmy.clevelandclinic.orgtimesofindiatribuneindia.com · 11 events

A four-year-old boy fell into a 220-foot-deep open borewell in Ambala district, Haryana.

A four-year-old boy fell into a 220-foot-deep open borewell in Ambala district, Haryana.
indiaother
The child's name is Nirbhay.
indiaother
1 corroborated · 9d ago · cluster ↗ · allafricapremiumtimestvcnews.tv · 11 events

The Nigerian Navy uncovered a hidden storage site and recovered 17,000 litres of crude oil.

The Nigerian Navy uncovered a hidden storage site and recovered 17,000 litres of crude oil.
africanigeria
4 corroborated · 9d ago · cluster ↗ · hindustantimes.comindianexpress.comptcnews.tvtimesofindiatimesofindia.indiatimes.com · 11 events

The incident occurred on Tuesday morning between 6:30 am and 7:00 am.

The incident occurred on Tuesday morning between 6:30 am and 7:00 am.
indiaother
Rescue operations are underway involving the State Disaster Response Force (SDRF), National Disaster Response Force (NDRF), and the Indian Army.
indiaother
5 corroborated · 9d ago · cluster ↗ · abc_aualjazeeraallafricabbcblueskydwfrance24hrw.org · 14 events

The Nigerian army freed 360 people abducted by Boko Haram.

The Nigerian army freed 360 people abducted by Boko Haram.
africaqatarwestern
The rescue operation took place in the Mandara mountains.
africaqatarwestern
1 corroborated · 9d ago · cluster ↗ · article.wn.comhinduhindustantimes.comindiatodayne.inm.dailyhunt.innewsonair.gov.intasstimesofindia · 7 events

The Nah Welfare Society, a tribal organization in Arunachal Pradesh, alleged that the Chinese PLA has encroached on Indian territory, built military camps, constructed roads, and built bridges in the Taksing Circle of the Upper Subansiri district.

The Nah Welfare Society, a tribal organization in Arunachal Pradesh, alleged that the Chinese PLA has encroached on Indian territory, built military camps, constructed roads, and built bridges in the Taksing Circle of the Upper Subansiri district.
indiaotherrussia
1 corroborated · 9d ago · cluster ↗ · factnewsindia.comtimesofindia · 10 events

The Indian Army is undergoing a transformation to become leaner, more agile, and technology-driven.

The Indian Army is undergoing a transformation to become leaner, more agile, and technology-driven.
indiaother
3 corroborated · 9d ago · cluster ↗ · article.wn.comhinduhindustantimes.comindiatodayne.inm.dailyhunt.innewsonair.gov.intimesofindia · 7 events

The Nah Welfare Society (NWS) has alleged that the Chinese PLA has occupied land in the Upper Subansiri district of Arunachal Pradesh, specifically at five locations: Oying (2445), Paniar, Marpan (Marnafe), Potrang Lake, and Tindingtang.

The Nah Welfare Society (NWS) has alleged that the Chinese PLA has occupied land in the Upper Subansiri district of Arunachal Pradesh, specifically at five locations: Oying (2445), Paniar, Marpan (Marnafe), Potrang Lake, and Tindingtang.
indiaother
The Nah Welfare Society alleges that the Chinese PLA has constructed military camps, roads, and bridges in the Upper Subansiri district of Arunachal Pradesh.
indiaother
5 corroborated · 10d ago · cluster ↗ · article.wn.comfactnewsindia.comidrw.orgtimesofindiatimesofindia.indiatimes.com · 10 events

The Indian Army is forming Integrated Battle Groups (IBGs) to enhance rapid deployment and precision strikes in future multi-domain conflicts.

The Indian Army is forming Integrated Battle Groups (IBGs) to enhance rapid deployment and precision strikes in future multi-domain conflicts.
indiaother
The Indian Army is introducing specialized drone units named Shaktibaan Regiments and Divyastra Batteries.
indiaother
3 corroborated · 10d ago · cluster ↗ · article.wn.comfactnewsindia.comindianexpress.comindiatoday.intimesofindiatimesofindia.indiatimes.com · 10 events

The Indian Army is forming Integrated Battle Groups (IBGs) to enable faster deployment and more agile combat operations.

The Indian Army is forming Integrated Battle Groups (IBGs) to enable faster deployment and more agile combat operations.
indiaother
The Indian Army is introducing Shaktibaan Regiments and Divyastra Batteries to enhance surveillance and precision targeting.
indiaother
0 corroborated · 10d ago · cluster ↗ · bharatshakti.intimesofindia · 10 events

The Indian Air Force is developing indigenous long-range kamikaze drones.

3 corroborated 1 contested · 10d ago · cluster ↗ · devdiscourse.comhinduhindustantimes.comm.dailyhunt.innewsonair.gov.inthenewsmill.comtimesofindia · 7 events

The Nah Welfare Society alleges that the Chinese People's Liberation Army (PLA) has established military camps, constructed roads, and built bridges on land it claims belongs to India in the Taksing circle of Upper Subansiri district, Arunachal Pradesh.

The Nah Welfare Society alleges that the Chinese People's Liberation Army (PLA) has established military camps, constructed roads, and built bridges on land it claims belongs to India in the Taksing circle of Upper Subansiri district, Arunachal Pradesh.
indiaother
Union Minister Kiren Rijiju highlighted ongoing road construction projects from Kaza to Keylong in Himachal Pradesh.
other
7 corroborated · 10d ago · cluster ↗ · allafricaallafrica.comneweralive.nasouthafricatoday.nettheconversation.com · 6 events

Farmers along the porous Liselo-Kamenga border in Zambezi are living in fear, as heavily armed cattle thieves continue to raid livestock posts.

Farmers along the porous Liselo-Kamenga border in Zambezi are living in fear, as heavily armed cattle thieves continue to raid livestock posts.
africaother
The rustlers have been tormenting farmers in the region, stealing large numbers of cattle and driving them into Zambia with impunity.
other
8 corroborated · 10d ago · cluster ↗ · allafricaallafrica.comneweralive.nasouthafricatoday.nettheconversation.com · 6 events

Farmers along the porous Liselo-Kamenga border in Zambezi are living in fear, as heavily armed cattle thieves continue to raid livestock posts.

Farmers along the porous Liselo-Kamenga border in Zambezi are living in fear, as heavily armed cattle thieves continue to raid livestock posts.
africaother
The rustlers have been tormenting farmers in the region, stealing large numbers of cattle and driving them into Zambia with impunity.
other
2 corroborated · 10d ago · cluster ↗ · hindurediff.comtimesofindia · 8 events

Indian Navy contingent to participate in Seychelles’ 50th Independence Day celebrations

Indian Navy contingent to participate in Seychelles’ 50th Independence Day celebrations
indiaother
Prime Minister Narendra Modi will attend Seychelles’ 50th Independence Day celebrations as Guest of Honour
indiaother
6 corroborated · 10d ago · cluster ↗ · hinduhindustantimes.comnewindianexpress.comrediff.comtimesofindiatimesofindia.indiatimes.comtribuneindia.com · 8 events

Indian Army contingent to participate in Seychelles’ 50th Independence Day celebrations

Indian Army contingent to participate in Seychelles’ 50th Independence Day celebrations
indiaother
Indian Navy contingent to participate in Seychelles’ 50th Independence Day celebrations
indiaother
6 corroborated · 10d ago · cluster ↗ · dailykiran.comhinduhindustantimes.comtimesofindiatimesofindia.indiatimes.comtopnewsjk.intribuneindia.com · 8 events

Prime Minister Narendra Modi will attend the 50th Independence Day celebrations of Seychelles as Guest of Honour.

Prime Minister Narendra Modi will attend the 50th Independence Day celebrations of Seychelles as Guest of Honour.
indiaother
An Indian Army marching contingent will participate in the 50th Independence Day celebrations of Seychelles.
indiaother
0 corroborated 3 contested · 11d ago · cluster ↗ · theprint.intimesofindia · 11 events

A 31-year-old Pakistani national named Rayees Khan was apprehended by Jammu and Kashmir Police after allegedly crossing the Line of Control into Indian territory in the Balakote sector of Poonch.

5 corroborated · 11d ago · cluster ↗ · karmasandhan.commynaukrialert.comrojgarlive.comsarkariresult.com.mutestbook.comtimesofindia · 6 events

Selected candidates must complete document verification and medical checks before receiving joining instructions.

Selected candidates must complete document verification and medical checks before receiving joining instructions.
indiaother
The Indian Army Agniveer Result 2026 is released separately for each Army Recruiting Office (ARO).
indiaother
5 corroborated · 11d ago · cluster ↗ · karmasandhan.commynaukrialert.comrojgarlive.comsarkariresult.com.mutestbook.comtimesofindia · 6 events

Selected candidates must complete document verification and medical checks before receiving joining instructions.

Selected candidates must complete document verification and medical checks before receiving joining instructions.
indiaother
The Indian Army releases ARO-wise selection lists for Agniveer 2026.
indiaother
1 corroborated · 12d ago · cluster ↗ · cnn.comkyivindependentkyivindependent.comkyivpost.commeduzatimesofindia.indiatimes.com · 7 events

The reform plan expands foreign recruitment.

The reform plan expands foreign recruitment.
otherukraine
0 corroborated · 12d ago · cluster ↗ · allafricadailypost.ng · 9 events

The Nigerian Army has reviewed recruit training curriculum to strengthen the capacity of newly enlisted soldiers to effectively tackle terrorism, insurgency and emerging security threats nationwide.

3 corroborated · 18d ago · cluster ↗ · dawnfrance24hindustantimeshindustantimes.commercopress · 12 events

Protests involved road blockades and barricades that disrupted food, fuel, and medical supplies.

Protests involved road blockades and barricades that disrupted food, fuel, and medical supplies.
indiaotherpakistanwestern
Food and medicine shortages occurred in major cities due to the protests.
otherwestern
5 corroborated 1 contested · 18d ago · cluster ↗ · aljazeerabbcblueskyfrance24guardianscmptasstimesnownews.com · 27 events

Ahmed Wishah worked for Al Jazeera Mubasher.

Ahmed Wishah worked for Al Jazeera Mubasher.
chinaotherqatarrussiawestern
Al Jazeera cameraman Ahmed Wishah was killed in an Israeli strike in Gaza.
otherqatarrussiawestern
4 corroborated 1 contested · 18d ago · cluster ↗ · aljazeerabbcblueskyfrance24guardiantasstimesnownews.com · 27 events

Al Jazeera cameraman Ahmed Wishah was killed in an Israeli strike in Gaza.

Al Jazeera cameraman Ahmed Wishah was killed in an Israeli strike in Gaza.
otherqatarrussiawestern
Ahmed Wishah worked for Al Jazeera Mubasher.
otherqatarrussiawestern
4 corroborated 1 contested · 18d ago · cluster ↗ · aljazeerabbcblueskyfrance24guardiantasstimesnownews.com · 27 events

Al Jazeera cameraman Ahmed Wishah was killed in an Israeli strike in Gaza.

Al Jazeera cameraman Ahmed Wishah was killed in an Israeli strike in Gaza.
otherqatarrussiawestern
Ahmed Wishah worked for Al Jazeera Mubasher.
otherqatarrussiawestern
7 corroborated · 18d ago · cluster ↗ · aljazeerabbcblueskyfrance24guardianiheart.commiddleeasteye.nettassthestatesman.comtimesnownews.com · 27 events

Al Jazeera cameraman Ahmed Wishah was killed in an Israeli strike in the Bureij refugee camp in central Gaza.

Al Jazeera cameraman Ahmed Wishah was killed in an Israeli strike in the Bureij refugee camp in central Gaza.
otherqatarrussiawestern
The Israeli military confirmed it carried out the strike that killed Ahmed Wishah.
otherwestern
3 corroborated · 18d ago · cluster ↗ · dawnfrance24hindustantimeshindustantimes.commercopress · 12 events

Protests involved road blockades and barricades that disrupted food, fuel, and medical supplies.

Protests involved road blockades and barricades that disrupted food, fuel, and medical supplies.
indiaotherpakistanwestern
Food and medicine shortages occurred in major cities due to the protests.
indiaotherwestern
3 corroborated · 19d ago · cluster ↗ · dawnfrance24hindustantimes.commercopress · 12 events

Protests included road blockades across Bolivia.

Protests included road blockades across Bolivia.
otherwestern
Protests caused severe food and medicine shortages in major cities.
otherwestern
1 corroborated · 21d ago · cluster ↗ · hinduindiatodayne.intimesofindia · 15 events

The carrying of swords by Reviewing Officers is now optional.

The carrying of swords by Reviewing Officers is now optional.
indiaother
1 corroborated 1 contested · 22d ago · cluster ↗ · allafricapremiumtimestvcnews.tv · 11 events

The Nigerian Navy uncovered a hidden storage site and recovered 17,000 litres of crude oil.

The Nigerian Navy uncovered a hidden storage site and recovered 17,000 litres of crude oil.
africanigeria
1 corroborated · 22d ago · cluster ↗ · raksha-anirveda.comtimesofindia · 10 events

The Indian Air Force is developing indigenous long-range kamikaze drones.

The Indian Air Force is developing indigenous long-range kamikaze drones.
indiaother
6 corroborated · 22d ago · cluster ↗ · blitzindiamedia.comidrw.orgraksha-anirveda.comtimesofindiatribuneindia.com · 10 events

The Indian Air Force is developing indigenous long-range kamikaze drones in partnership with Indian industry.

The Indian Air Force is developing indigenous long-range kamikaze drones in partnership with Indian industry.
indiaother
The Indian Air Force has issued a limited tender enquiry to select Indian companies for the development of one-way attack unmanned aerial systems (OWA-UAS).
indiaother
8 corroborated · 22d ago · cluster ↗ · idrw.orgm.dailyhunt.inraksha-anirveda.comtheweek.intimesofindiatribuneindia.com · 10 events

The Indian Air Force is developing indigenous long-range kamikaze drones.

The Indian Air Force is developing indigenous long-range kamikaze drones.
indiaother
The Indian Air Force issued a limited tender enquiry on June 12 to select Indian companies for the kamikaze drone project.
other
6 corroborated · 22d ago · cluster ↗ · argentina.gob.arm.dailyhunt.inmarknteladvisors.comraksha-anirveda.comtimesofindiatribuneindia.com · 10 events

The Indian Air Force is developing indigenous long-range kamikaze drones.

The Indian Air Force is developing indigenous long-range kamikaze drones.
indiaother
The Indian Air Force has invited bids from Indian companies for the indigenous long-range kamikaze drone project.
indiaother

Tracked clusters not yet corroborated · 20

17 events from websearch · updated 1d ago
2 events from websearch, yna · updated 1d ago
10 events from websearch · updated 2d ago
4 events from websearch · updated 2d ago
14 events from websearch · updated 4d ago
7 events from websearch · updated 4d ago
2 events from websearch · updated 5d ago
2 events from websearch · updated 6d ago
2 events from dawn, websearch · updated 6d ago
2 events from websearch, yna · updated 7d ago
2 events from websearch · updated 7d ago